Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
EXTRAS & NEWS!

Here will be information on our shows and our meets.

EXTRAS & NEWS!
Tunerfest 2026 with Broken Spannerz
Tunerfest 2026 with Broken Spannerz
Heart Shaped Hangers
Heart Shaped Hangers
£5.00
Ford Power Live at Brands Hatch
Ford Power Live at Brands Hatch
Downsouth Festival with Broken Spannerz 2nd AUGUST 2026
Downsouth Festival with Broken Spannerz 2nd AUGUST 2026
Bromley Pageant with Modded Defiance & Broken Spannerz
Bromley Pageant with Modded Defiance & Broken Spannerz
Broken Spannerz Mini Flag
Broken Spannerz Mini Flag
£1.00
Broken Spannerz Car Convoy Flags
Broken Spannerz Car Convoy Flags
£6.00
BHP 3rd May 2026
BHP 3rd May 2026
All Ford's with Broken Spannerz & Modded Defiance 5th JULY..
All Ford's with Broken Spannerz & Modded Defiance 5th JULY..
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract